What is FASTA and how is it used?

FASTA is among the most popular formats for storing biological sequence data. Here is what it is and how it is used.

What is FASTA?

The FASTA format is a text-based file format for storing protein and nucleic acid sequences. FASTA files commonly have the .fasta or .fa file extensions.

A FASTA file can contain one or more sequences. A sequence "block" in FASTA starts with a single-line description. The description line always begins with a greater-than character (>).

The sequence description line is immediately followed by the lines of sequence data. The residues in the sequence are represented using single-letter codes.

Here is an example of one protein sequence in the FASTA format:

>FER1_ARATH
    MASTALSSAIVSTSFLRRQQTPISLRSLPFANTQSLFGLKSSTARGGRVTAMATYKVKFI
    TPEGEQEVECEEDVYVLDAAEEAGLDLPYSCRAGSCSSCAGKVVSGSIDQSDQSFLDDEQ
    MSEGYVLTCVAYPTSDVVIETHKEEAIM

Bottom line

Whether you perform sequence analysis on a daily basis or only occasionally run BLAST, it is important that you are familiar with the FASTA format and can easily open FASTA file and navigate their contents.

See also

Made by Anton Vasetenkov in Auckland, New Zealand. me if you want to discuss a project.